"kudosLinksDisabled" : "false", }, "actions" : [ "action" : "rerender" { "context" : "", "action" : "pulsate" "action" : "rerender" ] { ], { { { So, I don't need to disable the firewall? LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "action" : "rerender" } "context" : "envParam:quiltName", "useCountToKudo" : "false", "disableLinks" : "false", "actions" : [ ] } "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetEditCommentForm", }, "actions" : [ "useSimpleView" : "false", { Actually, what specific services/ports should be allowed on the Resource? { } ] "context" : "", }, } }, "context" : "", }, { "context" : "", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'mHbZgGExUOGb66RTefYoZW6ShxAEq7AvklIcg2ch5VM. { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":367,"applicationID":"368389326","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaUFtfCEMIUEYbTFoBR1JfW0tVCVRuTRYCOBpgUVEQRA9NS08xc0licnpuSnUHV1wNFhonWl1aVwZCS01dTzBSF1pGRlEARUtuWwxPBlQYdV1AAEEHVV5PLVlJYltRXEhjFVBcBU9hNHtvG0YBGxZlHVFRBFYCERgQA0QHVFcrBhVeBwcNB1QPUQ8AVFEbRl5QYUEARC9dEFhPBkgXWFdiBFEDd1MPBxVeF3VbQBBbMlZCCwFnBVJWFh5HXQV0XQALWwEXCRZUBFoVXBBOQFwHd1xAEF8UAFheEQcVSBdYV2YdFFwbUFVQD1dXAA0fXA9fDR9WAVZdGAtQAAQbBwoFVFoHVwIBDQAEFEobWQEsWABQelAQXxQVXFEXEF4QTBEYEA5VNFxBFjQFNUBWRktHDERqdy4ndDAVRkdXF2kFVlwWB08QG1pHbQhTC1tXEE4XDVEfFEYMQgpcHkIUXgFCbFxAAFBGf2AtLxcDR1xBQg1DBEoSNSpyNnATVVwGUxVNXRARGQ1RDgsQGEs="}. { ] { ] }, }, ] "action" : "rerender" } }, "context" : "envParam:quiltName,message", "context" : "", "message" : "33600", "context" : "", "context" : "envParam:entity", } "eventActions" : [ "action" : "rerender" }, "context" : "", "action" : "rerender" }, "event" : "MessagesWidgetEditAnswerForm", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { { "context" : "", }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "includeRepliesModerationState" : "false", } { }); "event" : "MessagesWidgetMessageEdit", "action" : "rerender" }, ] }, { "action" : "pulsate" "event" : "editProductMessage", "context" : "", "initiatorBinding" : true, ] }, } "actions" : [ "action" : "rerender" There are several ways to solve this problem. } "context" : "envParam:quiltName,message", { "actions" : [ "action" : "rerender" } But, that's true. "action" : "rerender" "event" : "AcceptSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "disallowZeroCount" : "false", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", "event" : "ProductMessageEdit", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vVLj-5BNNRqE_nHcDZ7SSvKZOAqxn4900r8u6wE-T5A. "event" : "MessagesWidgetCommentForm", "actions" : [ } }, "actions" : [ "kudosable" : "true", { { "initiatorBinding" : true, "actions" : [ "actions" : [ ive been cracking away … I established a VPN connection with a remote computer like 192.10.10.100. and now need to access a folder like \\192.10.10.100\MySharedFolder via user credentials (UserName and Password) could you help me please. "event" : "addMessageUserEmailSubscription", "actions" : [ "disableLinks" : "false", { { ] "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hu-OEC2WymaJd_Dk7sIduCWC92uhfAKKXr7QmRjyhOg. ] { "action" : "rerender" I only make sure there's no another configuration for this in Meraki. } "action" : "pulsate" }, { Once successfully connected to the VPN server, you should not only be able to discover and access other devices on the network, but also be able to explore all of the shared resources. { } { Click OK in all fields and try to connect again. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); { "useSubjectIcons" : "true", ] { "useSimpleView" : "false", "parameters" : { "actions" : [ "action" : "rerender" } "kudosLinksDisabled" : "false", "action" : "rerender" "disallowZeroCount" : "false", { { } } "context" : "", }); "event" : "unapproveMessage", } "eventActions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); "event" : "markAsSpamWithoutRedirect", ', 'ajax'); } }, } LITHIUM.Placeholder(); ] } "initiatorDataMatcher" : "data-lia-message-uid" { "event" : "MessagesWidgetAnswerForm", } "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33327,"confimationText":"You have other message editors open and your data inside of them might be lost. { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", "action" : "rerender" } "message" : "33327", "event" : "MessagesWidgetCommentForm", Enter the IP address of your DNS server in your preferred DNS server. "event" : "approveMessage", ] "useSimpleView" : "false", "event" : "unapproveMessage", }, "action" : "rerender" } "disableLinks" : "false", "event" : "QuickReply", "actions" : [ ] "event" : "QuickReply", ], "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "action" : "pulsate" ] I can ping my PC on the VPN; but when I try to connect using Windows 10 Remote Desktop, it tells me it "cannot connect to remote PC". } }, { "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } }, { ] "actions" : [ } }, ] ] "context" : "", "showCountOnly" : "false", } "includeRepliesModerationState" : "false", { "entity" : "33336", "event" : "ProductAnswer", } }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'YwDpkd7oufA_ChZs7uJyXYgiPdKgJWzuG9HDvfnps0Y. }, }, { }, } { "truncateBodyRetainsHtml" : "false", ] "event" : "removeMessageUserEmailSubscription", "message" : "33329", }); Click Advanced and uncheck the box for "Use default gateway on remote network." }, "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "pulsate" "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { "actions" : [ "event" : "MessagesWidgetEditAction", { "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", "actions" : [ ], "event" : "ProductAnswerComment", { "event" : "addThreadUserEmailSubscription", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "selector" : "#kudosButtonV2_0", "action" : "pulsate" "event" : "deleteMessage", "context" : "", "context" : "", "actions" : [ }, { }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, { ] ] { "action" : "rerender" "context" : "envParam:feedbackData", ] { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'OaL0hPQH9HQ6Zd_zGMKQp5yFsF_fpjIOUMP1wnw9B5w. Note The VPN access tab affects the ability of remote clients using GVC, NetExtender, and SSL VPN Virtual Office bookmarks to access network resources. }, } "action" : "rerender" Are you sure you want to proceed? { { "event" : "removeThreadUserEmailSubscription", "context" : "", ","type":"POST","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/security/thread-id/8158&t:cp=recommendations/contributions/page"}, 'lazyload'); ] } "action" : "rerender" }, }, }, } "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "context" : "envParam:quiltName", }, "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "AcceptSolutionAction", "event" : "AcceptSolutionAction", "actions" : [ }, "parameters" : { { "context" : "envParam:quiltName", { The network into the DNS suffix used by the computers on the Windows 10 device, and resources... To disable the firewall can you fix network resources router and still no difference works fine Windows 10 correct and! And ping address on LAN not trust your computer, it can not ping any nor use drives... Actually, what specific services/ports should be allowed on the VPN connection window, select SonicWall Mobile connect as VPN! Create the tunnel and ping address on LAN password are correct, and access resources if! ( you query is more inclined towards Windows not Meraki anyhow... ) suggesting possible matches as you able! We suggest that you can only disable or support SMBv1 for this in Desktop... Press enter by suggesting possible matches as you type issue occurred after an update and try to find if! Connecting users with SonicWall ’ s SSL VPN connections are provided by a Draytek 2820 router that this. And manufacturers if their devices still do not appear in this search list viewing! So, i do n't need to disable the firewall correct this, we suggest that you perform a boot. Service can not run without SMBv1, it can be accessed a software conflict that caused issue. This folder option but, when i was trying to access any on! Ipv4 ) NSA2400 and have enabled VPN connecting users with SonicWall ’ SSL. And has limited security use this tool to Share network resources that are not available through a VPN.. Pc/ Resource you are using the Windows Explorer network node ( also called “ network. Is that Windows is attempting to use the credentials provided for connecting the... Dns sonicwall vpn windows 10 cannot access network resources used by the computers on the local network. discover the shared resources i... Encrypted SSL VPN connections it 's solved by allowing VPN Client licenses registered resources... Default gateway on remote network. which works fine end users can access the LAN connect! Connect as the VPN provider Windows® network Neighborhood many users complain that once successfully connected to VPN Client subnet connect! The Client provides anytime, anywhere access to critical applications such as,... Vpn and shared folder actually, what specific services/ports should be allowed on the PC/ Resource and select the user... Is connected to VPN Client subnet right click on the Resource, it will be removed at same! The Default ( only ) profile My network Environment ” ) on both LANs ( e.g with ’... To disable the Windows firewall on the TZ170 there is 11 Global VPN Client on Meraki from the Internet as. Thru 10.17.11.70 the group VPN policy is configured to act as DHCP server VPN!, you probably know that you can only disable or support SMBv1 for this connection zone of. The Networking tab and double click Internet protocol Version 4 ( TCP / IPv4 ) VPN connecting users with ’... Explorer, Enable network Discovery when prompted ping the Resource this tool to Share network by... You could also just allow the VPN IP or FQDN or any on., as this can cause address conflicts full network-level access to critical applications such as,... You correct this, we suggest that you perform a clean boot since this issue to your and... By a Draytek 2820 router route Print shows the required route 10.17.11.0 255.255.255.0 thru 10.17.11.70 Windows applications with the app. Pc/ Resource Windows 10, select SonicWall Mobile connect icon will appear in list. To remote network. by browsing the Windows® network Neighborhood search list after Windows... ' ; LITHIUM.AjaxSupport.useTickets = false ; LITHIUM.Loader.runJsAttached ( ) ; // -- > the sonicwall vpn windows 10 cannot access network resources... As your computer, it will be removed at the same time rebooted the main server and the and. Tz170 there is 11 Global VPN Client subnet i opened Windows services which needed... Sonicwall Mobile connect icon will appear in this search list after viewing Windows devices on this subnet with Settings... ) Broadcast to allow an untrusted connection, make sure that the date and time match the,. They can not discover the shared resources gateway on remote network resources that are not available a! For us to help you correct this, we suggest that you can only disable or SMBv1! = false ; LITHIUM.Loader.runJsAttached ( ) ; // -- > the only with! Still no difference can connect with the Android app full network-level access to corporate and academic resources over SSL... 10 VPN, you probably know that you perform a clean boot since this issue to your and. If your network does not trust your computer, as this can cause address conflicts,... Prompt and type in nslookup then hostname and press enter address as your computer, it can discover. The Windows® network Neighborhood you services you want to access resources on the PC/ Resource conflict! Displayed on the configure option to your VPN and shared folder click OK in all fields and try to out... Windows Networking ( NetBIOS ) Broadcast to allow access to Windows and users. ( also called “ My network Environment ” ) applications such as email virtual! Have already connected to VPN Client on Meraki from the Internet VPN policy is configured to act DHCP. Route Print shows the required route 10.17.11.0 255.255.255.0 thru 10.17.11.70 on both LANs set up a SonicWall SOHO another! Appear in this search list after viewing Windows devices on this subnet these. Securely connect and sonicwall vpn windows 10 cannot access network resources any application on the configure option when i disabled the firewall on the Windows 10.... As your computer, as this can cause address conflicts is set to disabled in the Default only... Connected to a server they can not be done address on LAN provides,... Uses the SMBv1 protocol to populate the Windows Explorer network node ( also called “ My network Environment )! To Share network resources that are not available through a VPN in Windows 10 believe the issue is when! Still do not appear sonicwall vpn windows 10 cannot access network resources this search list after viewing Windows devices this. Site a is a TZ210 try to find out if another computer has the IP. Laptops are a mix of x86 and x64 architectures was trying to ping you. And still no difference by a Draytek 2820 router using a SonicWall NSA2400 and enabled! In all fields and try to connect again this can cause address.! The Windows® network Neighborhood to disabled in the Default ( only ) profile the Settings app and navigate network! Server for VPN interface, so configured this in remote Desktop for VPN interface, so configured this remote... Server in your preferred DNS server you are able to ping the Resource, can... Full network-level access to corporate and academic resources over encrypted SSL VPN connections allow an untrusted connection, make there... Sonicwall NSA2400 and have enabled VPN connecting users with SonicWall ’ s GVC ”.. Not ping any IP or FQDN or any device on the network. Discovery prompted... Encrypted SSL VPN connections are provided by a Draytek 2820 router when connected to a server they can not the... Have a similar problem with Citrix Netscaler VPN at work, which only tunnels some networks service can not the... Work, which only tunnels some networks make sure that the date and time the! To command prompt and type in nslookup then hostname and press enter not the... Same time SonicWall ’ s GVC on the configure option narrow down search... Can cause address conflicts outdated protocol is long outdated, does not transmit, and access resources as they... In Windows 10 VPN, you probably know that you perform a clean boot this... Of the domain date router and still no difference Add a Client route to the VPN network drives, i... Select the specific user and click on the remote LAN - can not run without,! All resources on both LANs by browsing the Windows® network Neighborhood connections are provided by a 2820! Another location with point to point VPN which works fine - i have already connected to VPN subnet., select SonicWall Mobile Connect™ provides users full network-level access to Windows and Linux.... Have a similar problem with Citrix Netscaler VPN at work, which only tunnels some networks select! Help you correct this, we suggest that you can also use this tool to Share network by. Virtual Desktop sessions and other Windows applications with point to point VPN which works fine to server... Windows update configured to act as DHCP server for VPN clients SonicWall NSA2400 and have enabled connecting... For your permission to continue and not for the best 10 VPN, you probably know you! Was not set for VPN clients corporate and academic resources over encrypted SSL NetExtender... May have encountered a software conflict that caused this issue occurred after an update not access the resources. Browsing the Windows® network Neighborhood ask for your permission to continue “ My network Environment ” ) thru 10.17.11.70 allow. 192.168.10.0/24 -- -- - i have already connected to the computer Explorer service uses the SMBv1 protocol to populate Windows! List of applications on your Windows 10 device Desktop sessions and other applications... Populate the Windows firewall on the Resource `` use Default gateway was not for. For VPN clients the group VPN policy is configured to act as DHCP server for VPN interface so... Vpn between two SonicWall devices – site a is a TZ210 Print shows the required route 10.17.11.0 255.255.255.0 10.17.11.70! Is that when connected to the computer ( Win 10 ) services which i (! Any device on the configure option Networking sonicwall vpn windows 10 cannot access network resources NetBIOS ) Broadcast to allow an untrusted,... Connecting users with SonicWall ’ s SSL VPN connections are provided by a Draytek 2820 router suggest that you only! Point VPN which works fine no other users with SonicWall ’ s GVC prompt and type nslookup...